![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.12: BAH domain [82061] (2 families) ![]() |
![]() | Family b.34.12.0: automated matches [191438] (1 protein) not a true family |
![]() | Protein automated matches [190644] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187716] (2 PDB entries) |
![]() | Domain d2fl7a_: 2fl7 A: [164425] automated match to d1m4za_ |
PDB Entry: 2fl7 (more details), 1.85 Å
SCOPe Domain Sequences for d2fl7a_:
Sequence, based on SEQRES records: (download)
>d2fl7a_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldgwqviitddqgrviddnnrrrsrkrggenvflkrisdglsfgkgesvifndnvtetys vyliheirlntlnnvveiwvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnev nkselyltaelseiwlkdfiavgqilpesqwndssidkiedrdflvryaceptaekfvpi difqiirrvkemepkqsdeylkrvsvpv
>d2fl7a_ b.34.12.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldgwqviitddqgrvienvflkrisdglsfgkgesvifndnvtetysvyliheirlvvei wvfsylrwfelkpklyyeqfrpdlikedhplefykdkffnevnkselyltaelseiwlkd fiavgqilpesqwiedrdflvryaceptaekfvpidifqiirrvkemepkqsdeylkrvs vpv
Timeline for d2fl7a_: