Lineage for d2fk3b1 (2fk3 B:133-189)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008192Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) (S)
    automatically mapped to Pfam PF12924
  5. 3008193Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 3008194Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 3008195Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 3008200Domain d2fk3b1: 2fk3 B:133-189 [164414]
    Other proteins in same PDB: d2fk3a2, d2fk3b2, d2fk3c2, d2fk3d2, d2fk3e2, d2fk3f2, d2fk3g2, d2fk3h2
    automated match to d1owta_
    complexed with cu

Details for d2fk3b1

PDB Entry: 2fk3 (more details), 2.4 Å

PDB Description: structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
PDB Compounds: (B:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fk3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk3b1 d.230.3.1 (B:133-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
ckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl

SCOPe Domain Coordinates for d2fk3b1:

Click to download the PDB-style file with coordinates for d2fk3b1.
(The format of our PDB-style files is described here.)

Timeline for d2fk3b1: