Lineage for d2fk2a1 (2fk2 A:133-189)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008192Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) (S)
    automatically mapped to Pfam PF12924
  5. 3008193Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 3008194Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 3008195Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 3008197Domain d2fk2a1: 2fk2 A:133-189 [164412]
    Other proteins in same PDB: d2fk2a2
    automated match to d1owta_
    complexed with cu1

Details for d2fk2a1

PDB Entry: 2fk2 (more details), 1.65 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'small unit cell' form, Cu(I)-bound
PDB Compounds: (A:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fk2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk2a1 d.230.3.1 (A:133-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
ckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl

SCOPe Domain Coordinates for d2fk2a1:

Click to download the PDB-style file with coordinates for d2fk2a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fk2a2