SCOPe 2.08: Domain d2fk1a1: 2fk1 A:133-189

Lineage for d2fk1a1 (2fk1 A:133-189)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families)
   automatically mapped to Pfam PF12924

5. Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)

6. Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)

8. Domain d2fk1a1: 2fk1 A:133-189 [164411]
   Other proteins in same PDB: d2fk1a2
   automated match to d1owta_
   complexed with cu

Details for d2fk1a1

PDB Entry: 2fk1, 1.6 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in 'small unit cell' form, Cu(II)-bound

PDB Compounds: (A:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fk1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fk1a1 d.230.3.1 (A:133-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
ckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl

Timeline for d2fk1a1:

• d2fk1a1 first appeared in SCOPe 2.01, called d2fk1a_
  
• d2fk1a1 appears in SCOPe 2.07