Lineage for d1aoig_ (1aoi G:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) Protein Histone H2A [47115] (3 species) 
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (1 PDB entry) 
Domain d1aoig_: 1aoi G: [16441]
Other proteins in same PDB: d1aoia_, d1aoib_, d1aoid_, d1aoie_, d1aoif_, d1aoih_
Details for d1aoig_
PDB Entry: 1aoi (more details), 2.8 Å
PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment
SCOP Domain Sequences for d1aoig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoig_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis)}
akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
SCOP Domain Coordinates for d1aoig_:
Click to download the PDB-style file with coordinates for d1aoig_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aoig_:
- d1aoig_ appears in SCOP 1.57
- d1aoig_ appears in the current release, SCOPe 2.08
View in 3D
