| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
| Family d.63.1.0: automated matches [191434] (1 protein) not a true family |
| Protein automated matches [190625] (4 species) not a true protein |
| Species Yersinia pestis [TaxId:187410] [187713] (2 PDB entries) |
| Domain d2fjtb_: 2fjt B: [164409] automated match to d2acaa1 complexed with so4 |
PDB Entry: 2fjt (more details), 1.9 Å
SCOPe Domain Sequences for d2fjtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjtb_ d.63.1.0 (B:) automated matches {Yersinia pestis [TaxId: 187410]}
fvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdladqqismvlre
mnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkfhit
vdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
Timeline for d2fjtb_: