SCOPe 2.04: Domain d2fjta_: 2fjt A:

Lineage for d2fjta_ (2fjt A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.0: automated matches [191434] (1 protein)
   not a true family

6. Protein automated matches [190625] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:187410] [187713] (1 PDB entry)

8. Domain d2fjta_: 2fjt A: [164408]
   automated match to d2acaa1
   complexed with so4

Details for d2fjta_

PDB Entry: 2fjt, 1.9 Å

PDB Description: adenylyl cyclase class iv from yersinia pestis

PDB Compounds: (A:) Adenylyl cyclase class IV

SCOPe Domain Sequences for d2fjta_:

Sequence; same for both SEQRES and ATOM records:

>d2fjta_ d.63.1.0 (A:) automated matches {Yersinia pestis [TaxId: 187410]}
sehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdladqqismv
lremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkf
hitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf

Timeline for d2fjta_:

• d2fjta_ first appeared in SCOPe 2.01
  
• d2fjta_ appears in SCOPe 2.03
  
• d2fjta_ appears in SCOPe 2.05
  
• d2fjta_ appears in the current release, SCOPe 2.08