Lineage for d2fjkc_ (2fjk C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085965Family c.1.10.2: Class II FBP aldolase [51591] (3 protein domains)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2085987Protein automated matches [190642] (2 species)
    not a true protein
  7. 2085997Species Thermus caldophilus [TaxId:272] [187712] (1 PDB entry)
  8. 2086000Domain d2fjkc_: 2fjk C: [164406]
    automated match to d1rv8a_
    complexed with 13p

Details for d2fjkc_

PDB Entry: 2fjk (more details), 2.2 Å

PDB Description: Crystal structure of Fructose-1,6-Bisphosphate Aldolase in Thermus caldophilus
PDB Compounds: (C:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d2fjkc_:

Sequence, based on SEQRES records: (download)

>d2fjkc_ c.1.10.2 (C:) automated matches {Thermus caldophilus [TaxId: 272]}
mlvtgleilrkaraegygvgafntnnmeftqaileaaeemkspvilalsegamkyggral
trmvvalaqearvpvavhldhgssyesvlkalregftsvmidkshedfetnvretkrvve
aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
ykgkgrpfidhprlariaklvpaplvlhgasavpqelverfraaggeigeasgihpedik
kaislgiakintdtdlrlaftalvretlgknpkefdprkylgpareavkevvksrmelfg
svgra

Sequence, based on observed residues (ATOM records): (download)

>d2fjkc_ c.1.10.2 (C:) automated matches {Thermus caldophilus [TaxId: 272]}
mlvtgleilrkaraegygvgafntnnmeftqaileaaeemkspvilalsegamkyggral
trmvvalaqearvpvavhldhgssyesvlkalregftsvmidkshedfetnvretkrvve
aahavgvtveaelgrlagieekdalltnpeearifmertgadylavaigtshgaykgkgr
pfidhprlariaklvpaplvlhgasavpqelverfraaggeigeasgihpedikkaislg
iakintdtdlrlaftalvretlgknpkefdprkylgpareavkevvksrmelfgsvgra

SCOPe Domain Coordinates for d2fjkc_:

Click to download the PDB-style file with coordinates for d2fjkc_.
(The format of our PDB-style files is described here.)

Timeline for d2fjkc_: