Lineage for d2fi5i_ (2fi5 I:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259421Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2259611Protein automated matches [190046] (4 species)
    not a true protein
  7. 2259612Species Cow (Bos taurus) [TaxId:9913] [186767] (13 PDB entries)
  8. 2259621Domain d2fi5i_: 2fi5 I: [164396]
    Other proteins in same PDB: d2fi5e_
    automated match to d2fi3i1
    complexed with ca, edo, na, so4

Details for d2fi5i_

PDB Entry: 2fi5 (more details), 1.58 Å

PDB Description: crystal structure of a bpti variant (cys38->ser) in complex with trypsin
PDB Compounds: (I:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d2fi5i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fi5i_ g.8.1.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggsrakrnnfksaedcmrtcgga

SCOPe Domain Coordinates for d2fi5i_:

Click to download the PDB-style file with coordinates for d2fi5i_.
(The format of our PDB-style files is described here.)

Timeline for d2fi5i_: