Lineage for d2fhxb_ (2fhx B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224808Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1224809Protein automated matches [190418] (5 species)
    not a true protein
  7. 1224831Species Pseudomonas aeruginosa [TaxId:287] [187706] (1 PDB entry)
  8. 1224833Domain d2fhxb_: 2fhx B: [164394]
    automated match to d1ddka_
    complexed with azi, cl, edo, zn

Details for d2fhxb_

PDB Entry: 2fhx (more details), 1.9 Å

PDB Description: pseudomonas aeruginosa spm-1 metallo-beta-lactamase
PDB Compounds: (B:) spm-1

SCOPe Domain Sequences for d2fhxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhxb_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl

SCOPe Domain Coordinates for d2fhxb_:

Click to download the PDB-style file with coordinates for d2fhxb_.
(The format of our PDB-style files is described here.)

Timeline for d2fhxb_: