SCOPe 2.05: Domain d2fhxa_: 2fhx A:

Lineage for d2fhxa_ (2fhx A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (10 PDB entries)

8. Domain d2fhxa_: 2fhx A: [164393]
   automated match to d1ddka_
   complexed with azi, cl, edo, zn

Details for d2fhxa_

PDB Entry: 2fhx, 1.9 Å

PDB Description: pseudomonas aeruginosa spm-1 metallo-beta-lactamase

PDB Compounds: (A:) spm-1

SCOPe Domain Sequences for d2fhxa_:

Sequence; same for both SEQRES and ATOM records:

>d2fhxa_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl

Timeline for d2fhxa_:

• d2fhxa_ first appeared in SCOPe 2.01
  
• d2fhxa_ appears in SCOPe 2.04
  
• d2fhxa_ appears in SCOPe 2.06
  
• d2fhxa_ appears in the current release, SCOPe 2.08