SCOPe 2.01: Domain d2fhny_: 2fhn Y:

Lineage for d2fhny_ (2fhn Y:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (19 PDB entries)

8. Domain d2fhny_: 2fhn Y: [164392]
   automated match to d1rava_
   complexed with bni, fmt; mutant

Details for d2fhny_

PDB Entry: 2fhn, 1.3 Å

PDB Description: avidin related protein avr4 (c122s, k109i mutant) in complex with bna

PDB Compounds: (Y:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2fhny_:

Sequence; same for both SEQRES and ATOM records:

>d2fhny_ b.61.1.1 (Y:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftrl

Timeline for d2fhny_:

• d2fhny_ is new in SCOPe 2.01-stable
  
• d2fhny_ appears in SCOPe 2.02
  
• d2fhny_ appears in the current release, SCOPe 2.08