Lineage for d2fhny_ (2fhn Y:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2396982Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2396994Domain d2fhny_: 2fhn Y: [164392]
    automated match to d1rava_
    complexed with bni, fmt; mutant

Details for d2fhny_

PDB Entry: 2fhn (more details), 1.3 Å

PDB Description: Avidin related protein AVR4 (C122S, K109I mutant) in complex with BNA
PDB Compounds: (Y:) Avidin-related protein 4/5

SCOPe Domain Sequences for d2fhny_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhny_ b.61.1.1 (Y:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
csltgkwtnnlgsimtiravnsrgeftgtyltavadnpgnitlspllgiqhkrasqptfg
ftvhwnfsesttvftgqcfidrngkevlktmwllrssvndisydwiatrvgynnftrl

SCOPe Domain Coordinates for d2fhny_:

Click to download the PDB-style file with coordinates for d2fhny_.
(The format of our PDB-style files is described here.)

Timeline for d2fhny_: