Lineage for d1hioa_ (1hio A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482600Protein Histone H2A [47115] (6 species)
  7. 1482676Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 1482686Domain d1hioa_: 1hio A: [16439]
    Other proteins in same PDB: d1hiob_, d1hioc_, d1hiod_

Details for d1hioa_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only
PDB Compounds: (A:) histone h2a

SCOPe Domain Sequences for d1hioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlp

SCOPe Domain Coordinates for d1hioa_:

Click to download the PDB-style file with coordinates for d1hioa_.
(The format of our PDB-style files is described here.)

Timeline for d1hioa_: