Lineage for d2hioa_ (2hio A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46311Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 46312Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 46313Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 46314Protein Histone H2A [47115] (3 species)
  7. 46318Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)
  8. 46323Domain d2hioa_: 2hio A: [16438]
    Other proteins in same PDB: d2hiob_, d2hioc_, d2hiod_

Details for d2hioa_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

SCOP Domain Sequences for d2hioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl

SCOP Domain Coordinates for d2hioa_:

Click to download the PDB-style file with coordinates for d2hioa_.
(The format of our PDB-style files is described here.)

Timeline for d2hioa_: