SCOP 1.69: Domain d1eqze_: 1eqz E:

Lineage for d1eqze_ (1eqz E:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (4 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (5 PDB entries)

8. Domain d1eqze_: 1eqz E: [16437]
   Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_

Details for d1eqze_

PDB Entry: 1eqz, 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqze_:

Sequence; same for both SEQRES and ATOM records:

>d1eqze_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
grgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltae
ilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkktd
shkakak

Timeline for d1eqze_:

• d1eqze_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqze_ appears in SCOP 1.67
  
• d1eqze_ appears in SCOP 1.71
  
• d1eqze_ appears in the current release, SCOPe 2.08