Lineage for d1eqza_ (1eqz A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440192Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 440193Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 440194Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 440195Protein Histone H2A [47115] (4 species)
  7. 440238Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (5 PDB entries)
  8. 440243Domain d1eqza_: 1eqz A: [16436]
    Other proteins in same PDB: d1eqzb_, d1eqzc_, d1eqzd_, d1eqzf_, d1eqzg_, d1eqzh_

Details for d1eqza_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqza_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
sgrgkqggkarakaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
eilelagnaardnkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpkkt
dshka

SCOP Domain Coordinates for d1eqza_:

Click to download the PDB-style file with coordinates for d1eqza_.
(The format of our PDB-style files is described here.)

Timeline for d1eqza_: