| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein (Apo)ferritin [47246] (8 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187702] (9 PDB entries) |
| Domain d2fg8h_: 2fg8 H: [164352] automated match to d1data_ complexed with cs |
PDB Entry: 2fg8 (more details), 2.5 Å
SCOPe Domain Sequences for d2fg8h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg8h_ a.25.1.1 (H:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
Timeline for d2fg8h_: