| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 protein domains) |
| Protein (Apo)ferritin [47246] (8 species) |
| Species Human (Homo sapiens) [TaxId:9606] [187702] (3 PDB entries) |
| Domain d2fg8g_: 2fg8 G: [164351] automated match to d1data_ complexed with cs |
| PDB Entry: 2fg8 (more details) PDB Description: structure of human ferritin l chain
PDB Compounds: (G:) ferritin light chainSCOP Domain Sequences for d2fg8g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg8g_ a.25.1.1 (G:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd
SCOP Domain Coordinates for d2fg8g_:
Click to download the PDB-style file with coordinates for d2fg8g_. (The format of our PDB-style files is described here.)
Timeline for d2fg8g_:
d2fg8g_ appears in SCOP 1.75A | d2fg8g_ (click for larger image) d2fg8g_ in context of chain d2fg8g_ in context of PDB Domains from other chains: d2fg8a_, d2fg8b_, d2fg8c_, d2fg8d_, d2fg8e_, d2fg8f_, d2fg8h_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |