Lineage for d2fg8f_ (2fg8 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2701031Species Human (Homo sapiens) [TaxId:9606] [187702] (9 PDB entries)
  8. 2701065Domain d2fg8f_: 2fg8 F: [164350]
    automated match to d1data_
    complexed with cs

Details for d2fg8f_

PDB Entry: 2fg8 (more details), 2.5 Å

PDB Description: Structure of Human Ferritin L Chain
PDB Compounds: (F:) ferritin light chain

SCOPe Domain Sequences for d2fg8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg8f_ a.25.1.1 (F:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd

SCOPe Domain Coordinates for d2fg8f_:

Click to download the PDB-style file with coordinates for d2fg8f_.
(The format of our PDB-style files is described here.)

Timeline for d2fg8f_: