Lineage for d1hq3e_ (1hq3 E:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279050Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 279051Protein Histone H2A [47115] (4 species)
  7. 279070Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)
  8. 279072Domain d1hq3e_: 1hq3 E: [16435]
    Other proteins in same PDB: d1hq3b_, d1hq3c_, d1hq3d_, d1hq3f_, d1hq3g_, d1hq3h_
    complexed with cl, po4

Details for d1hq3e_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3e_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp

SCOP Domain Coordinates for d1hq3e_:

Click to download the PDB-style file with coordinates for d1hq3e_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3e_: