Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2fg8e_ (2fg8 E:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein (Apo)ferritin [47246] (8 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [187702] (3 PDB entries)
  8. Domain d2fg8e_: 2fg8 E: [164349]
    automated match to d1data_
    complexed with cs

Details for d2fg8e_

PDB Entry: 2fg8 (more details)
PDB Description: structure of human ferritin l chain
PDB Compounds: (E:) ferritin light chain

SCOP Domain Sequences for d2fg8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg8e_ a.25.1.1 (E:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]}
ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre
gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar
tdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd

SCOP Domain Coordinates for d2fg8e_:

Click to download the PDB-style file with coordinates for d2fg8e_.
(The format of our PDB-style files is described here.)

Timeline for d2fg8e_:

d2fg8e_ appears in SCOP 1.75A


d2fg8e_
(click for larger image)


d2fg8e_ in context of chain



d2fg8e_ in context of PDB
Domains from other chains:
d2fg8a_, d2fg8b_, d2fg8c_, d2fg8d_, d2fg8f_, d2fg8g_, d2fg8h_


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu