![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.1: Phospholipase C [48538] (3 proteins) |
![]() | Protein Bacterial phosholipase C [48539] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [48540] (7 PDB entries) |
![]() | Domain d2ffza_: 2ffz A: [164343] automated match to d1ah7a_ complexed with zn |
PDB Entry: 2ffz (more details), 2.05 Å
SCOPe Domain Sequences for d2ffza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffza_ a.124.1.1 (A:) Bacterial phosholipase C {Bacillus cereus [TaxId: 1396]} wsaqdkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaadyenpy ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd tygdr
Timeline for d2ffza_: