Lineage for d2ffza_ (2ffz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730190Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2730191Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2730192Family a.124.1.1: Phospholipase C [48538] (3 proteins)
  6. 2730210Protein Bacterial phosholipase C [48539] (1 species)
  7. 2730211Species Bacillus cereus [TaxId:1396] [48540] (7 PDB entries)
  8. 2730218Domain d2ffza_: 2ffz A: [164343]
    automated match to d1ah7a_
    complexed with zn

Details for d2ffza_

PDB Entry: 2ffz (more details), 2.05 Å

PDB Description: structural studies examining the substrate specificity profiles of pc- plcbc protein variants
PDB Compounds: (A:) phospholipase c

SCOPe Domain Sequences for d2ffza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffza_ a.124.1.1 (A:) Bacterial phosholipase C {Bacillus cereus [TaxId: 1396]}
wsaqdkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaadyenpy
ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl
gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa
vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd
tygdr

SCOPe Domain Coordinates for d2ffza_:

Click to download the PDB-style file with coordinates for d2ffza_.
(The format of our PDB-style files is described here.)

Timeline for d2ffza_: