Class a: All alpha proteins [46456] (171 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (3 families) |
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (4 species) |
Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries) |
Domain d1hq3a_: 1hq3 A: [16434] Other proteins in same PDB: d1hq3b_, d1hq3c_, d1hq3d_, d1hq3f_, d1hq3g_, d1hq3h_ |
PDB Entry: 1hq3 (more details), 2.15 Å
SCOP Domain Sequences for d1hq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hq3a_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes} kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk
Timeline for d1hq3a_: