SCOPe 2.06: Domain d2feoa_: 2feo A:

Lineage for d2feoa_ (2feo A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187701] (2 PDB entries)

8. Domain d2feoa_: 2feo A: [164338]
   automated match to d1ckea_
   complexed with dc, so4; mutant

Details for d2feoa_

PDB Entry: 2feo, 2.8 Å

PDB Description: mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp

PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d2feoa_:

Sequence; same for both SEQRES and ATOM records:

>d2feoa_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnmavaplvpaadalvldsttlsieqviekalqyarqk

Timeline for d2feoa_:

• d2feoa_ first appeared in SCOPe 2.01
  
• d2feoa_ appears in SCOPe 2.05
  
• d2feoa_ appears in SCOPe 2.07
  
• d2feoa_ appears in the current release, SCOPe 2.08