Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [187701] (2 PDB entries) |
Domain d2feoa_: 2feo A: [164338] automated match to d1ckea_ complexed with dc, so4; mutant |
PDB Entry: 2feo (more details), 2.8 Å
SCOPe Domain Sequences for d2feoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2feoa_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd drdrnmavaplvpaadalvldsttlsieqviekalqyarqk
Timeline for d2feoa_: