Lineage for d2feoa_ (2feo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866247Species Escherichia coli [TaxId:562] [187701] (2 PDB entries)
  8. 2866249Domain d2feoa_: 2feo A: [164338]
    automated match to d1ckea_
    complexed with dc, so4; mutant

Details for d2feoa_

PDB Entry: 2feo (more details), 2.8 Å

PDB Description: mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d2feoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feoa_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnmavaplvpaadalvldsttlsieqviekalqyarqk

SCOPe Domain Coordinates for d2feoa_:

Click to download the PDB-style file with coordinates for d2feoa_.
(The format of our PDB-style files is described here.)

Timeline for d2feoa_: