SCOPe 2.06: Domain d2fema_: 2fem A:

Lineage for d2fema_ (2fem A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187701] (2 PDB entries)

8. Domain d2fema_: 2fem A: [164337]
   automated match to d1ckea_
   mutant

Details for d2fema_

PDB Entry: 2fem, 1.9 Å

PDB Description: mutant r188m of the cytidine monophosphate kinase from e. coli

PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d2fema_:

Sequence, based on SEQRES records:

>d2fema_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnmavaplvpaadalvldsttlsieqviekalqyarqklala

Sequence, based on observed residues (ATOM records):

>d2fema_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeiklvp
aadalvldsttlsieqviekalqyarqklala

Timeline for d2fema_:

• d2fema_ first appeared in SCOPe 2.01
  
• d2fema_ appears in SCOPe 2.05
  
• d2fema_ appears in SCOPe 2.07
  
• d2fema_ appears in the current release, SCOPe 2.08