Lineage for d2fema_ (2fem A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109738Protein automated matches [190087] (10 species)
    not a true protein
  7. 2109745Species Escherichia coli [TaxId:562] [187701] (2 PDB entries)
  8. 2109746Domain d2fema_: 2fem A: [164337]
    automated match to d1ckea_
    mutant

Details for d2fema_

PDB Entry: 2fem (more details), 1.9 Å

PDB Description: Mutant R188M of the Cytidine Monophosphate Kinase From E. Coli
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d2fema_:

Sequence, based on SEQRES records: (download)

>d2fema_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnmavaplvpaadalvldsttlsieqviekalqyarqklala

Sequence, based on observed residues (ATOM records): (download)

>d2fema_ c.37.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeiklvp
aadalvldsttlsieqviekalqyarqklala

SCOPe Domain Coordinates for d2fema_:

Click to download the PDB-style file with coordinates for d2fema_.
(The format of our PDB-style files is described here.)

Timeline for d2fema_: