SCOPe 2.04: Domain d2fe4a_: 2fe4 A:

Lineage for d2fe4a_ (2fe4 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)

8. Domain d2fe4a_: 2fe4 A: [164336]
   automated match to d1yzqa1
   complexed with gdp, mg, no3

Details for d2fe4a_

PDB Entry: 2fe4, 2.3 Å

PDB Description: The crystal structure of human neuronal Rab6B in its inactive GDP-bound form

PDB Compounds: (A:) Ras-related protein Rab-6B

SCOPe Domain Sequences for d2fe4a_:

Sequence; same for both SEQRES and ATOM records:

>d2fe4a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagqe
rfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdladk
rqitieegeqrakelsvmfietsaktgynvkqlfrrvasalle

Timeline for d2fe4a_:

• d2fe4a_ first appeared in SCOPe 2.01
  
• d2fe4a_ appears in SCOPe 2.03
  
• d2fe4a_ appears in SCOPe 2.05
  
• d2fe4a_ appears in the current release, SCOPe 2.08, called d2fe4a1