Lineage for d2fd3a_ (2fd3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876231Domain d2fd3a_: 2fd3 A: [164331]
    automated match to d1xoaa_
    mutant

Details for d2fd3a_

PDB Entry: 2fd3 (more details), 2.45 Å

PDB Description: crystal structure of thioredoxin mutant p34h
PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d2fd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd3a_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcghckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d2fd3a_:

Click to download the PDB-style file with coordinates for d2fd3a_.
(The format of our PDB-style files is described here.)

Timeline for d2fd3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fd3b_