Lineage for d2fche_ (2fch E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 991975Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 992037Protein Thioredoxin [52835] (14 species)
  7. 992053Species Escherichia coli [TaxId:562] [52836] (44 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 992102Domain d2fche_: 2fch E: [164328]
    automated match to d1xoaa_
    complexed with mpd; mutant

Details for d2fche_

PDB Entry: 2fch (more details), 2.6 Å

PDB Description: crystal structure of thioredoxin mutant g74s
PDB Compounds: (E:) Thioredoxin 1

SCOPe Domain Sequences for d2fche_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fche_ c.47.1.1 (E:) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirsiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d2fche_:

Click to download the PDB-style file with coordinates for d2fche_.
(The format of our PDB-style files is described here.)

Timeline for d2fche_: