SCOPe 2.01: Domain d2fc2a_: 2fc2 A:

Lineage for d2fc2a_ (2fc2 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187412] (3 PDB entries)

8. Domain d2fc2a_: 2fc2 A: [164322]
   automated match to d1m7va_
   complexed with har, hbi, hem, no

Details for d2fc2a_

PDB Entry: 2fc2, 2.2 Å

PDB Description: NO-HEME complex in a bacterial nitric oxide synthase. An Fe(III)-NO may cause nitrosation.

PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2fc2a_:

Sequence; same for both SEQRES and ATOM records:

>d2fc2a_ d.174.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
shmeilwneakafiaecyqelgkeeevkdrldsikseidltgsyvhtkeelehgakmawr
nsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekgek
qveiwnhqliryagyeaagerigdpascsltaaceqlgwrgertdfdllplifrmkgdeq
pvwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymg
teigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivd
hhtaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkp
ye

Timeline for d2fc2a_:

• d2fc2a_ is new in SCOPe 2.01-stable
  
• d2fc2a_ appears in SCOPe 2.02
  
• d2fc2a_ appears in the current release, SCOPe 2.08, called d2fc2a1