Lineage for d2fbdb_ (2fbd B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926535Species House fly (Musca domestica) [TaxId:7370] [187696] (3 PDB entries)
  8. 2926541Domain d2fbdb_: 2fbd B: [164321]
    automated match to d1gd6a_
    complexed with peg, so4

Details for d2fbdb_

PDB Entry: 2fbd (more details), 1.9 Å

PDB Description: the crystallographic structure of the digestive lysozyme 1 from musca domestica at 1.90 ang.
PDB Compounds: (B:) Lysozyme 1

SCOPe Domain Sequences for d2fbdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbdb_ d.2.1.0 (B:) automated matches {House fly (Musca domestica) [TaxId: 7370]}
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf

SCOPe Domain Coordinates for d2fbdb_:

Click to download the PDB-style file with coordinates for d2fbdb_.
(The format of our PDB-style files is described here.)

Timeline for d2fbdb_: