![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries) |
![]() | Domain d2fb8b_: 2fb8 B: [164319] automated match to d1uwha_ complexed with 215 |
PDB Entry: 2fb8 (more details), 2.9 Å
SCOPe Domain Sequences for d2fb8b_:
Sequence, based on SEQRES records: (download)
>d2fb8b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh aksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirmq dknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpka mkrlmaeclkkkrderplfpqilasiellars
>d2fb8b_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh aksiihrdlksnniflhedltvkigdfglatvsgsilwmapevirmqdknpysfqsdvya fgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkr derplfpqilasiellars
Timeline for d2fb8b_: