Lineage for d2fb2b_ (2fb2 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102457Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) (S)
    common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel
  5. 2102467Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
    open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463
  6. 2102468Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)
  7. 2102469Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries)
    Uniprot P69848
  8. 2102471Domain d2fb2b_: 2fb2 B: [164317]
    automated match to d1tv7a_
    complexed with sam, sf4, so4; mutant

Details for d2fb2b_

PDB Entry: 2fb2 (more details), 2.25 Å

PDB Description: structure of the moaa arg17/266/268/ala triple mutant
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein A

SCOPe Domain Sequences for d2fb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb2b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq

SCOPe Domain Coordinates for d2fb2b_:

Click to download the PDB-style file with coordinates for d2fb2b_.
(The format of our PDB-style files is described here.)

Timeline for d2fb2b_: