| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.28: Radical SAM enzymes [102114] (3 families) ![]() common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel |
| Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein) open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463 |
| Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries) Uniprot P69848 |
| Domain d2fb2b_: 2fb2 B: [164317] automated match to d1tv7a_ complexed with sam, sf4, so4; mutant |
PDB Entry: 2fb2 (more details), 2.25 Å
SCOPe Domain Sequences for d2fb2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb2b_ c.1.28.3 (B:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
qikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvya
elgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrri
nvsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmley
fkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyrh
kdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdeelke
qfkalwqirddrysdertaqtvanrq
Timeline for d2fb2b_: