SCOPe 2.08: Domain d2fb2a_: 2fb2 A:

Lineage for d2fb2a_ (2fb2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.28: Radical SAM enzymes [102114] (3 families)
   common Fe-S cluster and SAM binding sites are embedded into complete or incomplete beta/alpha-barrel

5. Family c.1.28.3: MoCo biosynthesis proteins [110388] (1 protein)
   open alpha/beta-barrel with a specific second FeS cluster-binding region corresponding to Pfam PF06463

6. Protein Molybdenum cofactor biosynthesis protein A MoaA [110389] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110390] (4 PDB entries)
   Uniprot P69848

8. Domain d2fb2a_: 2fb2 A: [164316]
   automated match to d1tv7a_
   complexed with sam, sf4, so4; mutant

Details for d2fb2a_

PDB Entry: 2fb2, 2.25 Å

PDB Description: structure of the moaa arg17/266/268/ala triple mutant

PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein A

SCOPe Domain Sequences for d2fb2a_:

Sequence; same for both SEQRES and ATOM records:

>d2fb2a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}
eqikdklgrpirdlalsvtdrcnfrcdycmpkevfgddfvflpknelltfdemariakvy
aelgvkkiritggeplmrrdldvliaklnqidgiediglttnglllkkhgqklydaglrr
invsldaiddtlfqsinnrnikattileqidyatsiglnvkvnvviqkginddqiipmle
yfkdkhieirfiefmdvgndngwdfskvvtkdemltmieqhfeidpvepkyfgevakyyr
hkdngvqfglitsvsqsfcstctaaalssdgkfygclfatvdgfnvkafirsgvtdeelk
eqfkalwqirddrysdertaqtvanrq

Timeline for d2fb2a_:

• d2fb2a_ first appeared in SCOPe 2.01
  
• d2fb2a_ appears in SCOPe 2.07