| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
| Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
| Protein automated matches [190472] (8 species) not a true protein |
| Species SARS coronavirus [TaxId:227859] [187695] (1 PDB entry) |
| Domain d2favb_: 2fav B: [164314] automated match to d2acfa1 complexed with apr |
PDB Entry: 2fav (more details), 1.8 Å
SCOPe Domain Sequences for d2favb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2favb_ c.50.1.2 (B:) automated matches {SARS coronavirus [TaxId: 227859]}
pvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatngam
qkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqdi
llapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyldnl
Timeline for d2favb_: