Lineage for d1i11a_ (1i11 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353028Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 353029Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 353030Family a.21.1.1: HMG-box [47096] (8 proteins)
  6. 353061Protein Sox-5 [47106] (1 species)
  7. 353062Species Mouse (Mus musculus) [TaxId:10090] [47107] (1 PDB entry)
  8. 353063Domain d1i11a_: 1i11 A: [16431]

Details for d1i11a_

PDB Entry: 1i11 (more details)

PDB Description: solution structure of the dna binding domain, sox-5 hmg box from mouse

SCOP Domain Sequences for d1i11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus)}
phikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqarls
kqhlekypdy

SCOP Domain Coordinates for d1i11a_:

Click to download the PDB-style file with coordinates for d1i11a_.
(The format of our PDB-style files is described here.)

Timeline for d1i11a_: