Lineage for d1i11a_ (1i11 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698007Protein Sox-5 [47106] (1 species)
  7. 2698008Species Mouse (Mus musculus) [TaxId:10090] [47107] (1 PDB entry)
  8. 2698009Domain d1i11a_: 1i11 A: [16431]

Details for d1i11a_

PDB Entry: 1i11 (more details)

PDB Description: solution structure of the dna binding domain, sox-5 hmg box from mouse
PDB Compounds: (A:) transcription factor sox-5

SCOPe Domain Sequences for d1i11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]}
phikrpmnafmvwakderrkilqafpdmhnsniskilgsrwkamtnlekqpyyeeqarls
kqhlekypdy

SCOPe Domain Coordinates for d1i11a_:

Click to download the PDB-style file with coordinates for d1i11a_.
(The format of our PDB-style files is described here.)

Timeline for d1i11a_: