SCOPe 2.01: Domain d2fa4a_: 2fa4 A:

Lineage for d2fa4a_ (2fa4 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (7 PDB entries)

8. Domain d2fa4a_: 2fa4 A: [164307]
   automated match to d1erva_

Details for d2fa4a_

PDB Entry: 2fa4, 2.38 Å

PDB Description: crystal structure of oxidized form from saccharomyces cerevisiae

PDB Compounds: (A:) Thioredoxin II

SCOPe Domain Sequences for d2fa4a_:

Sequence; same for both SEQRES and ATOM records:

>d2fa4a_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtqlksaseydsalasgdklvvvdffatwcgpckmiapmiekfaeqysdaafykldvde
vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv

Timeline for d2fa4a_:

• d2fa4a_ is new in SCOPe 2.01-stable
  
• d2fa4a_ appears in SCOPe 2.02
  
• d2fa4a_ appears in the current release, SCOPe 2.08