Lineage for d2f9pb_ (2f9p B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954573Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)
  8. 954677Domain d2f9pb_: 2f9p B: [164302]
    automated match to d1ltoa_
    complexed with bu3, nag; mutant

Details for d2f9pb_

PDB Entry: 2f9p (more details), 2.3 Å

PDB Description: crystal structure of the recombinant human alpha i tryptase mutant d216g in complex with leupeptin
PDB Compounds: (B:) Tryptase alpha-1

SCOPe Domain Sequences for d2f9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9pb_ b.47.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2f9pb_:

Click to download the PDB-style file with coordinates for d2f9pb_.
(The format of our PDB-style files is described here.)

Timeline for d2f9pb_: