SCOPe 2.07: Domain d2f9od_: 2f9o D:

Lineage for d2f9od_ (2f9o D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d2f9od_: 2f9o D: [164300]
   automated match to d1ltoa_
   mutant

Details for d2f9od_

PDB Entry: 2f9o, 2.1 Å

PDB Description: crystal structure of the recombinant human alpha i tryptase mutant d216g

PDB Compounds: (D:) Tryptase alpha-1

SCOPe Domain Sequences for d2f9od_:

Sequence; same for both SEQRES and ATOM records:

>d2f9od_ b.47.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2f9od_:

• d2f9od_ first appeared in SCOPe 2.01
  
• d2f9od_ appears in SCOPe 2.06
  
• d2f9od_ appears in the current release, SCOPe 2.08