Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries) |
Domain d2f9od_: 2f9o D: [164300] automated match to d1ltoa_ mutant |
PDB Entry: 2f9o (more details), 2.1 Å
SCOPe Domain Sequences for d2f9od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9od_ b.47.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy vpk
Timeline for d2f9od_: