Lineage for d1hrza_ (1hrz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725631Protein SRY [47104] (1 species)
  7. 1725632Species Human (Homo sapiens) [TaxId:9606] [47105] (5 PDB entries)
  8. 1725637Domain d1hrza_: 1hrz A: [16430]
    protein/DNA complex

Details for d1hrza_

PDB Entry: 1hrz (more details)

PDB Description: the 3d structure of the human sry-dna complex solved by multi- dimensional heteronuclear-edited and-filtered nmr
PDB Compounds: (A:) human sry

SCOPe Domain Sequences for d1hrza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrza_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]}
drvkrpmnafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqklq
amhrekypnykyr

SCOPe Domain Coordinates for d1hrza_:

Click to download the PDB-style file with coordinates for d1hrza_.
(The format of our PDB-style files is described here.)

Timeline for d1hrza_: