SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2f9oc_ (2f9o C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057530Species Human (Homo sapiens) [TaxId:9606] [187233] (142 PDB entries)
  8. 2057627Domain d2f9oc_: 2f9o C: [164299]
    automated match to d1ltoa_
    mutant

Details for d2f9oc_

PDB Entry: 2f9o (more details), 2.1 Å

PDB Description: Crystal Structure of the Recombinant Human Alpha I Tryptase Mutant D216G
PDB Compounds: (C:) Tryptase alpha-1

SCOPe Domain Sequences for d2f9oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9oc_ b.47.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvrdrywmhfcggslihpqwvltaahcvgpdvkdlatlrvql
reqhlyyqdqllpvsriivhpqfyiiqtgadialleleepvnissrvhtvmlppasetfp
pgmpcwvtgwgdvdndeplpppfplkqvkvpimenhicdakyhlgaytgddvriirddml
cagnsqrdsckgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2f9oc_:

Click to download the PDB-style file with coordinates for d2f9oc_.
(The format of our PDB-style files is described here.)

Timeline for d2f9oc_: