SCOPe 2.08: Domain d2f8qb_: 2f8q B:

Lineage for d2f8qb_ (2f8q B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (28 species)
   not a true protein

7. Species Bacillus sp. [TaxId:65673] [187690] (11 PDB entries)

8. Domain d2f8qb_: 2f8q B: [164283]
   automated match to d1hiza_
   complexed with mg

Details for d2f8qb_

PDB Entry: 2f8q, 2.2 Å

PDB Description: an alkali thermostable f/10 xylanase from alkalophilic bacillus sp. ng-27

PDB Compounds: (B:) alkaline thermostable endoxylanase

SCOPe Domain Sequences for d2f8qb_:

Sequence; same for both SEQRES and ATOM records:

>d2f8qb_ c.1.8.3 (B:) automated matches {Bacillus sp. [TaxId: 65673]}
qpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpeeg
vftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqankel
llerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafet
arkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptidei
rtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyeel
dadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

Timeline for d2f8qb_:

• d2f8qb_ first appeared in SCOPe 2.01
  
• d2f8qb_ appears in SCOPe 2.07