Lineage for d2f8pa_ (2f8p A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087980Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1088012Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 1088015Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (8 PDB entries)
    Uniprot Q27709
  8. 1088021Domain d2f8pa_: 2f8p A: [164281]
    automated match to d1el4a_
    complexed with ca, cei

Details for d2f8pa_

PDB Entry: 2f8p (more details), 1.93 Å

PDB Description: crystal structure of obelin following ca2+ triggered bioluminescence suggests neutral coelenteramide as the primary excited state
PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d2f8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8pa_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglyg

SCOPe Domain Coordinates for d2f8pa_:

Click to download the PDB-style file with coordinates for d2f8pa_.
(The format of our PDB-style files is described here.)

Timeline for d2f8pa_: