| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calcium-regulated photoprotein [47512] (4 species) structurally most similar to sarcoplasmic calcium-binding protein |
| Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (8 PDB entries) Uniprot Q27709 |
| Domain d2f8pa_: 2f8p A: [164281] automated match to d1el4a_ complexed with ca, cei has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2f8p (more details), 1.93 Å
SCOPe Domain Sequences for d2f8pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8pa_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
askyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
ldpeadglyg
Timeline for d2f8pa_: